PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG013826.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family EIL
Protein Properties Length: 662aa    MW: 75079.5 Da    PI: 5.1883
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG013826.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3518.82.3e-158474271354
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  +el++rmw+d+mll+rlke++k+     e+ ++++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+Lr+WWkek
  CCG013826.1  47 DELERRMWRDRMLLRRLKEQSKN----TEV-VDNAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVSGASDNLRGWWKEK 139
                  79*******************98....566.999**************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fdrngpaaiskyqa+++i+++++++   + s++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww+++gl+kdqg+ppyk
  CCG013826.1 140 VRFDRNGPAAISKYQADHAIPGKREDCGP-AASTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVAPPWWPTGNEEWWPQQGLPKDQGPPPYK 236
                  ************************99977.89****************************************************************** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX..XXXXXXXXXXXXXXXXXXXX.XXXXXX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss..slrkqspkvtlsceqkedve.gkkesk 291
                  kphdlkkawkvsvLtavikh+sp+i++ir+l+ qsk+lqdkm+akes+++l+++nqee++ ++++++s    +  +s ++++s+++++dve +++e++
  CCG013826.1 237 KPHDLKKAWKVSVLTAVIKHLSPDIAKIRKLVCQSKCLQDKMTAKESATWLAIINQEEALSRKLYPDSCipMSAGGSGSFIISDSSDYDVEgVDDEPN 334
                  *******************************************************************65546667****************6677777 PP

                  .XXXXXXXXXX................................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
         EIN3 292 ikhvqavktta................................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                    +v+ +k  +                                ++++++krk++ +e+ ++ +++v + c+  q+++++++++f d ++++++++
  CCG013826.1 335 -VEVEDCKPLDvnlfnmataaaprdrfmmppgapqikgehvetNMSFIQKRKQPAGEPHMMVDQKV-YRCEYPQCPYNDSRIGFLDVTARNNHQM 427
                  .66888888778**************************************************9986.**************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.1E-13047294No hitNo description
Gene3DG3DSA:1.10.3180.102.9E-75169304IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.48E-61173297IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MGIYEEMEFC NNLDFFSAPP GEMDVVPERE PEATIEEDYS DEEMDVDELE RRMWRDRMLL  60
RRLKEQSKNT EVVDNAKQRQ SQEQARRKKM SRAQDGILKY MLKMMEVCKA QGFVYGIIPE  120
KGKPVSGASD NLRGWWKEKV RFDRNGPAAI SKYQADHAIP GKREDCGPAA STPHTLQELQ  180
DTTLGSLLSA LMQHCDPPQR RFPLEKGVAP PWWPTGNEEW WPQQGLPKDQ GPPPYKKPHD  240
LKKAWKVSVL TAVIKHLSPD IAKIRKLVCQ SKCLQDKMTA KESATWLAII NQEEALSRKL  300
YPDSCIPMSA GGSGSFIISD SSDYDVEGVD DEPNVEVEDC KPLDVNLFNM ATAAAPRDRF  360
MMPPGAPQIK GEHVETNMSF IQKRKQPAGE PHMMVDQKVY RCEYPQCPYN DSRIGFLDVT  420
ARNNHQMNCS YRTNTSQGFG MSNFQINSDK PAVFSLPFPQ TKAAAPNQTP SFNVSGLGLP  480
EDGKKSISDL MSFYDTNLQR DKNMNPGSAN VVGDQTQQQL QEQKFQFHLD RRNVSFMGDQ  540
NLLQQQQQQK FQFQLDSRNA NVVGGQNQHQ QQKFQFQVDD SFYGQGAIMG NNITEVTSMP  600
VNNSAFPSTE IEFDHCKAFD SAFDANVNDN VVDFRFGSPF TMPPVEYSMD PMPKQDAGMW  660
YV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-811713041134Protein ETHYLENE INSENSITIVE 3
4zds_B5e-811713041134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT6274070.0KT627407.1 Populus x jrtyschensis isolate 20F-pj73-1-1 EIN3-like family protein (EIN3) gene, partial cds.
GenBankKT6274090.0KT627409.1 Populus x jrtyschensis isolate 20F-pj73-1 EIN3-like family protein (EIN3) gene, partial cds.
GenBankKT6274110.0KT627411.1 Populus x jrtyschensis isolate 20F-pj80-1 EIN3-like family protein (EIN3) gene, partial cds.
GenBankKT6274130.0KT627413.1 Populus x jrtyschensis isolate 20F-pj81-1-1 EIN3-like family protein (EIN3) gene, partial cds.
GenBankKT6274150.0KT627415.1 Populus x jrtyschensis isolate 20F-pj81-1 EIN3-like family protein (EIN3) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011032978.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLB9HK870.0B9HK87_POPTR; EIN3-like family protein
STRINGPOPTR_0008s01200.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein